PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04889A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 596aa    MW: 66010 Da    PI: 7.682
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04889AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-1765111148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g WT+eEde l +av  + g++Wk+Ia+ ++ +Rt+ qc +rwqk+l
  Oropetium_20150105_04889A  65 KGGWTPEEDENLRKAVSAFKGRHWKKIAEFVP-HRTEVQCLHRWQKVL 111
                                688*****************************.************986 PP

2Myb_DNA-binding58.71.4e-18117163148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g+WT+eEd++++++vk++G++ W+ Ia+ +  gR +kqc++rw+++l
  Oropetium_20150105_04889A 117 KGSWTQEEDDIIINLVKKHGPKKWSVIASSLD-GRIGKQCRERWHNHL 163
                                799*****************************.*************97 PP

3Myb_DNA-binding55.61.2e-17169212146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                + +WT eE+  l++a++ +G++ W+ Ia+ ++ gRt++++k++w++
  Oropetium_20150105_04889A 169 KEAWTVEEEHVLANAHHVYGNK-WAEIAKLLP-GRTDNSIKNHWNS 212
                                579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.21660111IPR017930Myb domain
SuperFamilySSF466897.9E-1561118IPR009057Homeodomain-like
SMARTSM007172.3E-1564113IPR001005SANT/Myb domain
PfamPF002494.2E-1565111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2267119IPR009057Homeodomain-like
CDDcd001672.92E-1368111No hitNo description
PROSITE profilePS5129430.926112167IPR017930Myb domain
SuperFamilySSF466891.03E-30114210IPR009057Homeodomain-like
SMARTSM007176.8E-17116165IPR001005SANT/Myb domain
PfamPF002493.2E-17117163IPR001005SANT/Myb domain
CDDcd001673.30E-15119163No hitNo description
Gene3DG3DSA:1.10.10.608.7E-26120166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-22167218IPR009057Homeodomain-like
PROSITE profilePS5129421.481168218IPR017930Myb domain
SMARTSM007179.2E-15168216IPR001005SANT/Myb domain
PfamPF002495.2E-16169212IPR001005SANT/Myb domain
CDDcd001672.37E-11171214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MTAVKVEERE GTAVDWRNLE VPLPPTSPLK TESCGGGAPM SPAVYSPADS VSAHRRTSGP  60
VRRAKGGWTP EEDENLRKAV SAFKGRHWKK IAEFVPHRTE VQCLHRWQKV LNPELVKGSW  120
TQEEDDIIIN LVKKHGPKKW SVIASSLDGR IGKQCRERWH NHLDPQIRKE AWTVEEEHVL  180
ANAHHVYGNK WAEIAKLLPG RTDNSIKNHW NSSLKKRLDH YKTSSTLPVS MPIVHDSLKH  240
VKKPIALNHI DLNKDPDMHL EGPPEIVGHS ERTSHLHACN VKDIKSCLEF LSLSMPTAQQ  300
EIPCEAVVAQ DSSVALAMQG LKLDAVDDKS TEYKIVCEGV GVGSLNLEAA DVGRIIDRMT  360
YSVPIRPGCK TDSNLCELSL MNESSSSLGS LCYQIPKLED IIPAHSPVFS RHHVQDNRVD  420
GFQSPIGFST FSPVDGNTRD QLSVESILKS AAETFPGTPS ILRRRKREKP LDAQESKIKI  480
DILNGDSFHT PVGKCAAVSP HSFKTATFLS LGPPDGEELS AALGSVDVSP AYRLRSKRMA  540
VVKSIERQLD FSMDEMDNHS TTTDILLKTT SWNTNSSTGV SSMPEKSMRK HIDLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-67642185159MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-67642185159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1462469RRRKREKP
2463468RRKREK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660295.10.0PREDICTED: myb-related protein A-like
RefseqXP_004961857.10.0PREDICTED: myb-related protein A-like
TrEMBLA0A0A9DCG70.0A0A0A9DCG7_ARUDO; Uncharacterized protein
STRINGSi021484m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-103myb domain protein 3r-5